General Information

  • ID:  hor006764
  • Uniprot ID:  Q8R414
  • Protein name:  Prokineticin-1
  • Gene name:  Prok1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  AVIT (prokineticin) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0001525 angiogenesis; GO:0001935 endothelial cell proliferation; GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045765 regulation of angiogenesis; GO:0051781 positive regulation of cell division; GO:0101023 vascular endothelial cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACERDVQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFFRKRQHHTCPCSPSLLCSRFPDGRYRCSQDLKNVNF
  • Length:  86
  • Propeptide:  MRGAVQVFIMLLLATVSDCAVITGACERDVQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFFRKRQHHTCPCSPSLLCSRFPDGRYRCSQDLKNVNF
  • Signal peptide:  MRGAVQVFIMLLLATVSDC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Prokr2, Prokr1
  • Target Unid:  Q8R415, Q8R416
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-Q8R414-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006764_AF2.pdbhor006764_ESM.pdb

Physical Information

Mass: 1110940 Formula: C410H650N130O117S10
Absent amino acids: M Common amino acids: CR
pI: 8.43 Basic residues: 16
Polar residues: 31 Hydrophobic residues: 23
Hydrophobicity: -34.53 Boman Index: -17564
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 64.65
Instability Index: 5315.7 Extinction Coefficient cystines: 7615
Absorbance 280nm: 89.59

Literature

  • PubMed ID:  12054613
  • Title:  Isolation and identification of EG-VEGF/prokineticins as cognate ligands for two orphan G-protein-coupled receptors.