General Information

  • ID:  hor006764
  • Uniprot ID:  Q8R414
  • Protein name:  Prokineticin-1
  • Gene name:  Prok1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  AVIT (prokineticin) family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0008083 growth factor activity
  • GO BP:  GO:0001525 angiogenesis; GO:0001935 endothelial cell proliferation; GO:0007165 signal transduction; GO:0008283 cell population proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045765 regulation of angiogenesis; GO:0051781 positive regulation of cell division; GO:0101023 vascular endothelial cell proliferation; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACERDVQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFFRKRQHHTCPCSPSLLCSRFPDGRYRCSQDLKNVNF
  • Length:  86(20-105)
  • Propeptide:  MRGAVQVFIMLLLATVSDCAVITGACERDVQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFFRKRQHHTCPCSPSLLCSRFPDGRYRCSQDLKNVNF
  • Signal peptide:  MRGAVQVFIMLLLATVSDC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of oth
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Prokr2, Prokr1
  • Target Unid:  Q8R415, Q8R416
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-77
  • Structure ID:  AF-Q8R414-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006764_AF2.pdbhor006764_ESM.pdb

Physical Information

Mass: 1110940 Formula: C410H650N130O117S10
Absent amino acids: M Common amino acids: CR
pI: 8.43 Basic residues: 16
Polar residues: 31 Hydrophobic residues: 23
Hydrophobicity: -34.53 Boman Index: -17564
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 64.65
Instability Index: 5315.7 Extinction Coefficient cystines: 7615
Absorbance 280nm: 89.59

Literature

  • PubMed ID:  12054613
  • Title:  Isolation and identification of EG-VEGF/prokineticins as cognate ligands for two orphan G-protein-coupled receptors.